🤖 BCH709 AI Assistant: Ask questions about this class using NotebookLM

BCH709 Introduction to Bioinformatics: 14_BLAST

Location

mkdir -p ~/bch709/BLAST
cd ~/bch709/BLAST

ENV

conda create -n blast -c bioconda -c conda-forge blast seqkit -y

BLAST

Basic Local Alignment Search Tool (Altschul et al., 1990 & 1997) is a sequence comparison algorithm optimized for speed used to search sequence databases for optimal local alignments to a query. The initial search is done for a word of length “W” that scores at least “T” when compared to the query using a substitution matrix. Word hits are then extended in either direction in an attempt to generate an alignment with a score exceeding the threshold of “S”. The “T” parameter dictates the speed and sensitivity of the search.

Rapidly compare a sequence Q to a database to find all sequences in the database with an score above some cutoff S.

Homologous sequence are likely to contain a short high scoring word pair, a seed.

– Unlike Baeza-Yates, BLAST doesn’t make explicit guarantees

BLAST then tries to extend high scoring word pairs to compute maximal high scoring segment pairs (HSPs).

– Heuristic algorithm but evaluates the result statistically.

seed seed

E-value

E-value = the number of HSPs having score S (or higher) expected to occur by chance.

Smaller E-value, more significant in statistics Bigger E-value , by chance

E[# occurrences of a string of length m in reference of length L] ~ L/4m

PAM and BLOSUM Matrices

Two different kinds of amino acid scoring matrices, PAM (Percent Accepted Mutation) and BLOSUM (BLOcks SUbstitution Matrix), are in wide use. The PAM matrices were created by Margaret Dayhoff and coworkers and are thus sometimes referred to as the Dayhoff matrices. These scoring matrices have a strong theoretical component and make a few evolutionary assumptions. The BLOSUM matrices, on the other hand, are more empirical and derive from a larger data set. Most researchers today prefer to use BLOSUM matrices because in silico experiments indicate that searches employing BLOSUM matrices have higher sensitivity.

There are several PAM matrices, each one with a numeric suffix. The PAM1 matrix was constructed with a set of proteins that were all 85 percent or more identical to one another. The other matrices in the PAM set were then constructed by multiplying the PAM1 matrix by itself: 100 times for the PAM100; 160 times for the PAM160; and so on, in an attempt to model the course of sequence evolution. Though highly theoretical (and somewhat suspect), it is certainly a reasonable approach. There was little protein sequence data in the 1970s when these matrices were created, so this approach was a good way to extrapolate to larger distances.

Protein databases contained many more sequences by the 1990s so a more empirical approach was possible. The BLOSUM matrices were constructed by extracting ungapped segments, or blocks, from a set of multiply aligned protein families, and then further clustering these blocks on the basis of their percent identity. The blocks used to derive the BLOSUM62 matrix, for example, all have at least 62 percent identity to some other member of the block.

PAM-250-and-Blosum-62-matrices

codon

BLAST has a number of possible programs to run depending on whether you have nucleotide or protein sequences:

nucleotide query and nucleotide db - blastn nucleotide query and nucleotide db - tblastx (includes six frame translation of query and db sequences) nucleotide query and protein db - blastx (includes six frame translation of query sequences) protein query and nucleotide db - tblastn (includes six frame translation of db sequences) protein query and protein db - blastp

blasttype

BLAST Process

step1 step2 step3 step4

blast

Web BLAST (NCBI)

https://blast.ncbi.nlm.nih.gov/Blast.cgi

NCBI provides a free web-based BLAST service that allows you to search your sequences against NCBI’s massive databases without installing any software. This is the easiest way to get started with BLAST.

How to Use Web BLAST

  1. Go to https://blast.ncbi.nlm.nih.gov/Blast.cgi
  2. Choose the appropriate BLAST program based on your query and database types:
Program Click on Query Type Database Type
blastn Nucleotide BLAST Nucleotide Nucleotide (nt, refseq_rna, etc.)
blastp Protein BLAST Protein Protein (nr, swissprot, pdb, etc.)
blastx blastx Nucleotide Protein (translated query)
tblastn tblastn Protein Nucleotide (translated database)
tblastx tblastx Nucleotide Nucleotide (both translated)
  1. Paste your sequence(s) in FASTA format or enter accession numbers in the query box
  2. Select the target database (e.g., nr, nt, swissprot, refseq_protein)
  3. (Optional) Set organism filter, E-value threshold, or other parameters under “Algorithm parameters”
  4. Click BLAST and wait for results

Web BLAST Interface Overview

web_blast

Input Section

Choose Search Set

Algorithm Parameters

Reading Web BLAST Results

The results page has several sections:

Graphic Summary

A color-coded bar diagram showing where hits align to your query. Colors indicate alignment scores:

Descriptions Table

A ranked list of database hits showing:

Alignments

Detailed pairwise alignments between your query and each hit, showing:

Web BLAST vs Local BLAST

Feature Web BLAST Local BLAST
Setup required None (just a browser) Install BLAST+, download databases
Database availability All NCBI databases (nr, nt, refseq, etc.) Must download each database
Database size limit Access to full NCBI databases (>100 GB) Limited by local disk space
Query limit ~100 sequences per submission Unlimited
Speed Depends on server load; queued Depends on local hardware
Customization Limited to web interface options Full command-line control
Reproducibility Results may change as databases update Fixed database version
Output formats HTML, XML, CSV, tabular All formats (including custom tabular)
Custom databases Not supported Build your own with makeblastdb
Batch processing Limited (use Batch Entrez for large jobs) Full scripting/automation
Best for Quick searches, small number of queries Large-scale analysis, pipelines, custom DBs

When to use Web BLAST: Use it for quick, one-off searches of a few sequences against NCBI databases. It requires no setup and gives you access to the latest, most comprehensive databases.

When to use Local BLAST: Use it when you have many query sequences (>100), need custom databases, require specific output formats, or need reproducible results with a fixed database version.

SmartBLAST

https://blast.ncbi.nlm.nih.gov/smartblast/

SmartBLAST is a simplified BLAST interface designed to quickly identify what a protein sequence is. It is ideal for students and researchers who need a fast answer without configuring parameters.

How SmartBLAST Works

  1. Paste a protein sequence (no FASTA header needed)
  2. SmartBLAST automatically runs the search and returns results in seconds
  3. Results show the top hits from landmark (well-annotated) sequences

What Makes SmartBLAST Different from Regular BLAST

Feature Regular Web BLAST SmartBLAST
Input FASTA format, multiple sequences Single protein sequence (paste directly)
Configuration Many parameters to set No configuration needed
Database User selects (nr, swissprot, etc.) Automatically uses landmark/nr
Speed Can take minutes Usually returns in seconds
Results Full alignments, detailed statistics Simplified view with top hits
Phylogenetic context No Shows a quick distance tree
Best for Detailed analysis Quick “what is this protein?”

SmartBLAST Results Include

SmartBLAST is the fastest way to answer “What protein is this?” Just paste a sequence and get an immediate answer with evolutionary context. It’s especially useful in the classroom for quick demonstrations.

Magic-BLAST

https://ncbi.github.io/magicblast/

Magic-BLAST is a specialized BLAST tool designed for mapping next-generation sequencing (NGS) reads (RNA-seq and DNA-seq) against a reference genome or transcriptome. It is optimized for short reads and spliced alignments, filling a niche between traditional BLAST and dedicated read mappers like HISAT2 or STAR.

Why Magic-BLAST?

Traditional BLAST was not designed for the millions of short reads produced by NGS platforms. Dedicated aligners (BWA, Bowtie2, HISAT2) are fast but use different algorithms. Magic-BLAST bridges the gap — it uses the familiar BLAST engine but optimized for:

Magic-BLAST vs Other Aligners

Feature BLAST Magic-BLAST HISAT2/STAR BWA-MEM
Designed for Individual sequences NGS reads RNA-seq reads DNA-seq reads
Spliced alignment No Yes Yes No
Long read support Yes Yes Limited Yes
Speed (millions of reads) Very slow Moderate Fast Fast
Output format BLAST formats SAM/BAM SAM/BAM SAM/BAM
Database makeblastdb makeblastdb or SRA accession Custom index Custom index
Requires genome index BLAST DB BLAST DB Specific index Specific index

Installation

conda create -n magicblast -c bioconda magicblast -y
conda activate magicblast

Basic Usage

## Map paired-end reads to a reference genome
magicblast -query reads_R1.fastq -query_mate reads_R2.fastq \
           -db reference_genome \
           -out results.sam \
           -num_threads 4 \
           -splice T    ## Enable spliced alignment for RNA-seq

## Map reads directly from SRA accession (no download needed!)
magicblast -sra SRR1234567 \
           -db reference_genome \
           -out results.sam \
           -num_threads 4

Key Magic-BLAST Options

Option Description
-query / -query_mate Input FASTQ/FASTA files (R1 and R2 for paired-end)
-sra SRA accession number (reads are streamed directly)
-db BLAST database of reference genome
-splice Enable spliced alignment (T/F, default: T)
-out Output file (SAM format by default)
-num_threads Number of CPU threads
-outfmt Output format: sam (default), tabular
-score Minimum alignment score
-max_intron_length Maximum intron size for spliced alignments (default: 500,000)

Magic-BLAST’s unique feature is the ability to directly stream reads from SRA accessions without downloading FASTQ files first. This saves disk space and time for exploratory analyses. However, for production RNA-seq pipelines, dedicated aligners like HISAT2 or STAR are typically faster and produce more refined spliced alignments.

IgBLAST

https://www.ncbi.nlm.nih.gov/igblast/

IgBLAST (Immunoglobulin BLAST) is a specialized BLAST tool for analyzing immunoglobulin (Ig) and T cell receptor (TCR) sequences. It is the standard tool for antibody sequence analysis, V(D)J gene assignment, and characterizing antibody repertoires.

Why IgBLAST?

Antibody and TCR genes are unique in biology — they are assembled by somatic recombination of V (Variable), D (Diversity), and J (Joining) gene segments, followed by somatic hypermutation. Standard BLAST cannot properly analyze these sequences because:

IgBLAST solves all of these problems.

What IgBLAST Reports

For each antibody/TCR sequence, IgBLAST identifies:

  1. V gene: Best matching germline V gene segment and allele
  2. D gene: Best matching D gene segment (for heavy chains)
  3. J gene: Best matching J gene segment
  4. CDR1, CDR2, CDR3: Complementarity-determining region sequences
  5. Framework regions: FR1, FR2, FR3, FR4 sequences
  6. Junction analysis: Detailed V-D-J junction with N-nucleotide additions and P-nucleotides
  7. Percent identity to germline: Shows the level of somatic hypermutation
  8. Rearrangement summary: Complete V(D)J gene assignment

Web IgBLAST

  1. Go to https://www.ncbi.nlm.nih.gov/igblast/
  2. Select Organism (human, mouse, rat, etc.)
  3. Choose Query type: Ig (immunoglobulin) or TCR (T cell receptor)
  4. Select Domain system: IMGT, Kabat, or Chothia numbering
  5. Paste your nucleotide or protein sequence
  6. Click BLAST

Command-line IgBLAST

## Install
conda create -n igblast -c bioconda igblast -y
conda activate igblast

## Run IgBLAST (requires germline database setup)
igblastn -query antibody_sequences.fasta \
         -germline_db_V imgt_human_V \
         -germline_db_D imgt_human_D \
         -germline_db_J imgt_human_J \
         -organism human \
         -domain_system imgt \
         -auxiliary_data optional_file/human_gl.aux \
         -outfmt "7 std qseq sseq" \
         -out igblast_results.txt

IgBLAST vs Regular BLAST for Antibody Sequences

Feature Regular BLAST IgBLAST
V(D)J gene identification No Yes (separate V, D, J assignments)
CDR/FR annotation No Yes (CDR1, CDR2, CDR3, FR1-4)
Junction analysis No Yes (N-additions, P-nucleotides)
Germline databases Generic (nr/nt) Specialized (IMGT, built-in)
Somatic mutation analysis No Yes (% identity to germline)
Numbering schemes None IMGT, Kabat, Chothia
Best for General sequence search Antibody/TCR repertoire analysis

IgBLAST is essential for anyone working in immunology, antibody engineering, or adaptive immune repertoire sequencing (AIRR-seq). For large-scale repertoire analysis (millions of sequences), consider pipeline tools like MiXCR, IMGT/HighV-QUEST, or Change-O that build on top of IgBLAST.

BLAST 2 Sequences (bl2seq)

BLAST 2 Sequences (bl2seq) allows you to directly compare two sequences against each other without building a database. This is useful when you want to see how two specific sequences align — for example, comparing two genes, checking if two contigs overlap, or visualizing the relationship between a query and a known reference.

Web BLAST 2 Sequences

  1. Go to https://blast.ncbi.nlm.nih.gov/Blast.cgi
  2. Select any BLAST program (e.g., Nucleotide BLAST or Protein BLAST)
  3. Check the “Align two or more sequences” checkbox
  4. Paste the first sequence in the Query box
  5. Paste the second sequence in the Subject box
  6. Click BLAST

blast2seq

Command-line bl2seq

In BLAST+, bl2seq functionality is built into the standard BLAST programs using the -subject flag instead of -db:

## Compare two nucleotide sequences (blastn)
blastn -query sequence1.fasta \
       -subject sequence2.fasta \
       -out bl2seq_results.txt \
       -outfmt 0

## Compare two protein sequences (blastp)
blastp -query protein1.fasta \
       -subject protein2.fasta \
       -out bl2seq_results.txt \
       -outfmt 0

## Translated comparison: nucleotide query vs protein subject (blastx)
blastx -query gene.fasta \
       -subject protein.fasta \
       -out bl2seq_results.txt \
       -outfmt 0

When using -subject instead of -db, you do not need to run makeblastdb — BLAST directly compares the two files. All output format options (-outfmt) work the same way.

Common Use Cases for bl2seq

Use Case Program Example
Compare two genes from different species blastn Are these orthologs? How conserved are they?
Compare a cDNA to genomic DNA blastn Find exon-intron boundaries
Check if two contigs overlap blastn Genome assembly validation
Compare protein isoforms blastp What regions differ between splice variants?
Compare a gene to a known protein blastx Verify the correct reading frame
Compare two genomes/chromosomes blastn Synteny analysis, structural rearrangements

Tabular Output for bl2seq

You can use tabular output just like regular BLAST:

## Tabular comparison with custom columns
blastn -query seq1.fasta \
       -subject seq2.fasta \
       -outfmt "6 qseqid sseqid pident length mismatch gapopen qstart qend sstart send evalue bitscore" \
       -out comparison.txt

Dot Plot Visualization

bl2seq results can be visualized as a dot plot — a 2D plot where one sequence is on the X-axis and the other on the Y-axis. Aligned regions appear as diagonal lines:

Tools for dot plot visualization:

## Using MUMmer for dot plot (alternative to bl2seq for large sequences)
conda install -c bioconda mummer -y

nucmer -p comparison genome1.fasta genome2.fasta
mummerplot -p dotplot --png comparison.delta

bl2seq is the simplest way to compare two sequences. For comparing entire genomes or very large sequences, consider MUMmer (nucmer/promer) which is optimized for whole-genome alignment and produces better dot plots.

Other Specialized BLAST Variants

NCBI and the community have developed several other BLAST variants for specific use cases:

PSI-BLAST (Position-Specific Iterated BLAST)

PSI-BLAST is built into the standard BLAST+ suite. It performs iterative protein searches to detect distant homologs that regular BLASTP might miss.

How it works:

  1. Run a standard BLASTP search
  2. Build a PSSM (Position-Specific Scoring Matrix) from the significant hits
  3. Search the database again using the PSSM instead of a generic BLOSUM matrix
  4. Repeat steps 2-3 for multiple iterations, detecting progressively more distant homologs
## Run PSI-BLAST with 3 iterations
psiblast -query protein.fasta \
         -db nr \
         -num_iterations 3 \
         -evalue 0.001 \
         -out psiblast_results.txt \
         -out_pssm pssm_checkpoint.pssm \
         -num_threads 4

PSI-BLAST is powerful for detecting remote homologs (< 20% identity) but beware of profile corruption: if a false positive enters the PSSM in early iterations, subsequent iterations will find more unrelated sequences. Always review results carefully and use strict E-value cutoffs.

DELTA-BLAST (Domain Enhanced Lookup Time Accelerated BLAST)

DELTA-BLAST searches a pre-constructed database of PSSMs (the Conserved Domain Database, CDD) before searching the protein database. This gives PSI-BLAST-level sensitivity in a single pass without iterative searching.

## Run DELTA-BLAST
deltablast -query protein.fasta \
           -db nr \
           -rpsdb cdd_delta \
           -evalue 0.001 \
           -out deltablast_results.txt \
           -num_threads 4

You can search NCBI databases remotely from the command line without downloading them:

## Remote BLASTP against nr (runs on NCBI servers)
blastp -query protein.fasta -db nr -remote -out remote_results.txt -outfmt 6

## Remote BLASTN against nt
blastn -query nucleotide.fasta -db nt -remote -out remote_results.txt -outfmt 6

Remote BLAST is useful for one-off searches against databases too large to download (nr is >300 GB). However, it depends on network speed and NCBI server load, and is subject to usage limits.

RPSBlast (Reverse Position-Specific BLAST)

RPSBlast searches a protein query against a database of PSSMs (profiles), typically the Conserved Domain Database (CDD). This is the engine behind NCBI’s CD-Search (Conserved Domain Search).

## Search for conserved domains in a protein
rpsblast -query protein.fasta \
         -db Cdd \
         -evalue 0.01 \
         -out domain_results.txt \
         -outfmt "6 qseqid sseqid pident evalue bitscore stitle"

Comparison of All BLAST Variants

Tool Type Best For Sensitivity Speed
blastn Nucleotide vs nucleotide DNA/RNA sequence search Standard Fast
blastp Protein vs protein Protein sequence search Standard Moderate
blastx Translated nt vs protein Gene finding, annotation Standard Slow
tblastn Protein vs translated nt Finding genes in genomes Standard Slow
tblastx Translated nt vs translated nt Comparing unannotated genomes Standard Very slow
PSI-BLAST Iterative protein search Remote homolog detection Very high Slow (iterative)
DELTA-BLAST Domain-enhanced protein search Remote homologs (single pass) Very high Moderate
RPSBlast Protein vs domain profiles Conserved domain identification High Fast
SmartBLAST Quick protein identification “What is this protein?” Standard Very fast
Magic-BLAST NGS read mapping RNA-seq, read alignment Moderate Moderate
IgBLAST Antibody/TCR analysis V(D)J assignment, repertoire Specialized Moderate
DIAMOND Ultra-fast protein aligner Large-scale blastx/blastp Adjustable 100-20,000x faster

NCBI BLAST API (for programmatic access)

For automated searches beyond the web interface, NCBI provides a REST API:

## Submit a BLAST search via command line using NCBI API
## Step 1: Submit the query (returns a Request ID / RID)
curl -X POST "https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi" \
     -d "CMD=Put&PROGRAM=blastp&DATABASE=nr&QUERY=MASGPGGWLGPAFALRLLLAAVLQPVSAFRA"

## Step 2: Check status (replace RID with the actual Request ID)
curl "https://blast.ncbi.nlm.nih.gov/blast/Blast.cgi?CMD=Get&FORMAT_TYPE=Text&RID=YOUR_RID"

For large-scale automated BLAST searches against NCBI databases, consider using the NCBI BLAST+ remote option: blastp -query input.fasta -db nr -remote. This runs the search on NCBI’s servers using the local command-line interface.

UniProt

https://www.uniprot.org/

UniProt (Universal Protein Resource) is the most comprehensive and widely used protein sequence and functional annotation database. It consists of three main components:

Why use UniProt for BLAST?

Feature NCBI nr UniProtKB/Swiss-Prot UniProtKB/TrEMBL
Size Very large (~600M seqs) Small (~570K seqs) Large (~250M seqs)
Annotation quality Variable Manually curated Automatic
Redundancy Low No redundancy Low
Search speed Slow Very fast Moderate
Best for Comprehensive search High-confidence annotation Broad coverage with annotation

Running BLASTP against UniProt locally

You can download UniProt databases for local BLAST searches:

cd ~/bch709/BLAST

## Download Swiss-Prot (small, manually curated)
wget https://ftp.uniprot.org/pub/databases/uniprot/current_release/knowledgebase/complete/uniprot_sprot.fasta.gz
gunzip uniprot_sprot.fasta.gz
makeblastdb -in uniprot_sprot.fasta -dbtype prot -parse_seqids

## Download individual protein FASTA files from UniProt REST API
wget https://rest.uniprot.org/uniprotkb/P12345.fasta
wget https://rest.uniprot.org/uniprotkb/P01308.fasta

## Run BLASTP against Swiss-Prot
blastp -query your_protein.fasta \
       -db uniprot_sprot.fasta \
       -outfmt "6 qseqid sseqid pident evalue bitscore stitle" \
       -evalue 1e-05 \
       -max_target_seqs 5 \
       -num_threads 4 \
       -out blastp_swissprot.txt

Swiss-Prot entries use accession numbers (e.g., P12345) and entry names (e.g., INS_HUMAN for human insulin). The stitle column in BLAST output will show the full description line including gene name, organism, and protein function.

Example entries on UniProt:

BLASTN example

Run blastn against the nt database.


ATGAAAGCGAAGGTTAGCCGTGGTGGCGGTTTTCGCGGTGCGCTGAACTA
CGTTTTTGACGTTGGCAAGGAAGCCACGCACACGAAAAACGCGGAGCGAG
TCGGCGGCAACATGGCCGGGAATGACCCCCGCGAACTGTCGCGGGAGTTC
TCAGCCGTGCGCCAGTTGCGCCCGGACATCGGCAAGCCCGTCTGGCATTG
CTCGCTGTCACTGCCTCCCGGCGAGCGCCTGAGCGCCGAGAAGTGGGAAG
CCGTCGCGGCTGACTTCATGCAGCGCATGGGCTTTGACCAGACCAATACG
CCGTGGGTGGCCGTGCGCCACCAGGACACGGACAAGGATCACATCCACAT
CGTGGCCAGCCGGGTAGGGCTGGACGGGAAAGTGTGGCTGGGCCAGTGGG
AAGCCCGCCGCGCCATCGAGGCGACCCAAGAGCTTGAGCATACCCACGGC
CTGACCCTGACGCCGGGGCTGGGCGATGCGCGGGCCGAGCGCCGGAAGCT
GACCGACAAGGAGATCAACATGGCCGTGAGAACGGGCGATGAACCGCCGC
GCCAGCGTCTGCAACGGCTGCTGGATGAGGCGGTGAAGGACAAGCCGACC
GCGCTAGAACTGGCCGAGCGGCTACAGGCCGCAGGCGTAGGCGTCCGGGC
AAACCTCGCCAGCACCGGGCGCATGAACGGCTTTTCCTTCGAGGTGGCCG
GAGTGCCGTTCAAAGGCAGCGACTTGGGCAAGGGCTACACATGGGCGGGG
CTACAGAAAGCAGGGGTGACTTATGACGAAGCTAGAGACCGTGCGGGCCT
TGAACGATTCAGGCCCACAGTTGCAGATCGTGGAGAGCGTCAGGACGTTG
CAGCAGTCCGTGAGCCTGATGCACGAGGACTTGAAGCGCCTACCGGGCGC
AGTCTCGACCGAGACGGCGCAGACCTTGGAACCGCTGGCCCGACTCCGGC
AGGACGTGACGCAGGTTCTGGAAGCCTACGACAAGGTGACGGCCATTCAG
CGCAAGACGCTGGACGAGCTGACGCAGCAGATGAGCGCGAGCGCGGCGCA
GGCCTTCGAGCAGAAGGCCGGGAAGCTGGACGCGACCATCTCCGACCTGT
CGCGCAGCCTGTCAGGGCTGAAAACGAGCCTCAGCAGCATGGAGCAGACC
GCGCAGCAGGTGGCGACCTTGCCGGGCAAGCTGGCGAGCGCACAGCAGGG
CATGACGAAAGCCGCCGACCAACTGACCGAGGCAGCGAACGAGACGCGCC
CGCGCCTTTGGCGGCAGGCGCTGGGGCTGATTCTGGCCGGGGCCGTGGGC
GCGATGCTGGTAGCGACTGGGCAAGTCGCTTTAAACAGGCTAGTGCCGCC
AAGCGACGTGCAGCAGACGGCAGACTGGGCCAACGCGATTTGGAACAAGG
CCACGCCCACGGAGCGCGAGTTGCTGAAACAGATCGCCAATCGGCCCGCG
AACTAGACCCGACCGCCTACCTTGAGGCCAGCGGCTACACCGTGAAGCGA
GAAGGGCGGCACCTGTCCGTCAGGGCGGGCGGTGATGAGGCGTACCGCGT
GACCCGGCAGCAGGACGGGCGCTGGCTCTGGTGCGACCGCTACGGCAACG
ACGGCGGGGACAATATCGACCTGGTGCGCGAGATCGAACCCGGCACCGGC
TACGCCGAGGCCGTCTATCGGCTTTCAGGTGCGCCGACAGTCCGGCAGCA
ACCGCGCCCGAGCGAGCCGAAGCGCCAACCGCCGCAGCTACCGGCGCAAG
GGCTGGCAGCCCGCGAGCATGGCCGCGACTACCTCAAGGGCCGGGGCATC
AGCCAGGACACCATCGAGCACGCCGAGAAGGCGGGCATGGTGCGCTATGC
AGACGGTGGAGTGCTGTTCGTCGGCTACGACCGTGCAGGCACCGCGCAGA
ACGCCACACGCCGCGCCATTGCCCCCGCTGACCCGGTGCAGAAGCGCGAC
CTACGCGGCAGCGACAAGAGCTATCCGCCGATCCTGCCGGGCGACCCGGC
AAAGGTCTGGATCGTGGAAGGTGGCCCGGATGCGCTGGCCCTGCACGACA
TCGCCAAGCGCAGCGGCCAGCAGCCGCCCACCGTCATCGTGTCAGGCGGG
GCGAACGTGCGCAGCTTCTTGGAGCGGGCCGACGTGCAAGCGATCCTGAA
GCGGGCCGAGCGCGTCACCGTGGCCGGGGAAAACGAGAAGAACCCCGAGG
CGCAGGCAAAGGCCGACGCCGGGCACCAGAAGCAGGCGCAGCGGGTGGCC
AAAATCACCGGGCGCGAGGTGCGCCAATGGACGCCGAAGCCCGAGCACGG
CAAGGACTTGGCCGACATGAACGCCCGGCAGGTGGCAGAGATCGAGCGCA
AGCGACAGGCCGAGATCGAGGCCGAAAGAGCACGAAACCGCGAGCTTTCA
CGCAAGAGCCGGAGGTATGATGGCCCCAGCTTCGGCAGATAA

BLASTP Query

Do a BLASTP on NCBI website with the following protein against nr, but limit the organism to cetartiodactyla using default parameters:

MASGPGGWLGPAFALRLLLAAVLQPVSAFRAEFSSESCRELGFSSNLLCSSCDLLGQFSL
LQLDPDCRGCCQEEAQFETKKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEK
LERI

Have a look at the multiple sequence alignment, can you explain the results?

Do a similar blastp vs UniProtKB (UniProt) without post filtering.

Running a standalone BLAST program

Location

cd ~/bch709/BLAST

ENV

conda activate blast

Running a standalone BLAST program

Create the index for the target database using makeblastdb; Choose the task program: blastn, blastp, blastx, tblatx, psiblast or deltablast; Set the configuration for match, mismatch, gap-open penalty, gap-extension penalty or scoring matrix; Set the word size; Set the E-value threshold; Set the output format and the number of output results

Standalone BLAST

In addition to providing BLAST sequence alignment services on the web, NCBI also makes these sequence alignment utilities available for download through FTP. This allows BLAST searches to be performed on local platforms against databases downloaded from NCBI or created locally. These utilities run through DOS-like command windows and accept input through text-based command line switches. There is no graphic user interface

https://www.ncbi.nlm.nih.gov/books/NBK52640/

ftp://ftp.ncbi.nlm.nih.gov/blast/db/

NR vs NT

At NCBI they are two different things as well. ‘nr’ is a database of protein sequences and ‘nt’ is nucleotide. At one time ‘nr’ meant non-redundant but it stopped being non-redundant a while ago. nt is a nucleotide database, while nr is a protein database (in amino acids)

Standalone BLAST

  1. Download the database.
  2. Use makeblastdb to build the index.
  3. Change the scoring matrix, record the changes in the alignment results and interpret the results.

Download Database

cd ~/bch709/BLAST
wget ftp://ftp.ncbi.nih.gov/refseq/release/plant/plant.1.protein.faa.gz

How many sequences in plant.1.protein.faa.gz

seqkit stats plant.1.protein.faa.gz

Download Input file

Download the Arabidopsis thaliana TAIR10 CDS sequences:

cd ~/bch709/BLAST
wget https://ftp.ensemblgenomes.org/pub/plants/release-60/fasta/arabidopsis_thaliana/cds/Arabidopsis_thaliana.TAIR10.cds.all.fa.gz -O Athaliana_TAIR10.cds.fa.gz --no-check-certificate

Example Input sequence

seqkit stats Athaliana_TAIR10.cds.fa.gz -T

Expected output (values may vary slightly depending on the source version):

file	format	type	num_seqs	sum_len	min_len	avg_len	max_len
Athaliana_TAIR10.cds.fa.gz	FASTA	DNA	35386	43546761	22	1230.6	16182

Subsampling by SeqKit

FASTA and FASTQ are basic and ubiquitous formats for storing nucleotide and protein sequences. Common manipulations of FASTA/Q file include converting, searching, filtering, deduplication, splitting, shuffling, and sampling. Existing tools only implement some of these manipulations, and not particularly efficiently, and some are only available for certain operating systems. Furthermore, the complicated installation process of required packages and running environments can render these programs less user friendly.

This project describes a cross-platform ultrafast comprehensive toolkit for FASTA/Q processing. SeqKit provides executable binary files for all major operating systems, including Windows, Linux, and Mac OS X, and can be directly used without any dependencies or pre-configurations. SeqKit demonstrates competitive performance in execution time and memory usage compared to similar tools. The efficiency and usability of SeqKit enable researchers to rapidly accomplish common FASTA/Q file manipulations.

Run BLAST

Make BLAST DB

makeblastdb -in your-nucleotide-db.fa -dbtype nucl ###for nucleotide sequence
makeblastdb -in your-protein-db.fas -dbtype prot ###for protein sequence

Run BLASTX

cd ~/bch709/BLAST
gunzip plant.1.protein.faa.gz
makeblastdb -in plant.1.protein.faa -dbtype prot
seqkit sample -n 100 Athaliana_TAIR10.cds.fa.gz > ATH_100.fasta
blastx -query ATH_100.fasta -db plant.1.protein.faa -outfmt 8

Tab output (default -outfmt 6 columns)

qseqid 		Query sequence ID
sseqid		Subject (ie DB) sequence ID
pident		Percent Identity across the alignment
length 		Alignment length
mismatch 	# of mismatches
gapopen 	Number of gap openings
qstart 		Start of alignment in query
qend 		End of alignment in query
sstart 		Start of alignment in subject
send		End of alignment in subject
evalue 		E-value
bitscore	Bit score

BLAST Key Options Explained

-outfmt : Output Format

Controls how results are displayed. This is one of the most important BLAST options.

Value Format Description
0 Pairwise Default human-readable alignment output
1 Query-anchored with identities Shows alignment relative to query
2 Query-anchored without identities Same as 1 but without identity markers
3 Flat query-anchored with identities Flat version of format 1
4 Flat query-anchored without identities Flat version of format 2
5 BLAST XML Machine-readable XML format
6 Tabular Tab-separated, no headers (most commonly used for parsing)
7 Tabular with comments Same as 6 but includes header lines starting with #
8 Seqalign (text ASN.1) Text ASN.1 format
10 CSV Comma-separated values
11 BLAST archive (ASN.1) Can be converted to other formats later with blast_formatter
12 Seqalign (JSON) JSON format
13 Multiple-file JSON JSON output split per query
14 Multiple-file XML2 XML2 output split per query
15 Single-file JSON Single JSON file
16 Single-file XML2 Single XML2 file
17 SAM Sequence Alignment/Map format (useful for genomics pipelines)
18 Organism Report Summary report organized by organism

Custom tabular columns (used with -outfmt 6 or -outfmt 7):

blastx -query ATH_100.fasta -db plant.1.protein.faa \
       -outfmt "6 qseqid sseqid pident length evalue bitscore stitle"

All available column specifiers:

Specifier Description
qseqid Query sequence ID
sseqid Subject sequence ID
pident Percentage of identical matches
length Alignment length
mismatch Number of mismatches
gapopen Number of gap openings
qstart / qend Start/end of alignment in query
sstart / send Start/end of alignment in subject
evalue Expect value
bitscore Bit score
score Raw score
qlen Query sequence length
slen Subject sequence length
qcovs Query coverage per subject
qcovhsp Query coverage per HSP
stitle Subject title (description)
salltitles All subject titles
sallseqid All subject sequence IDs
qframe Query frame
sframe Subject frame
nident Number of identical matches
positive Number of positive-scoring matches
gaps Total number of gaps
ppos Percentage of positive-scoring matches
staxids Subject taxonomy ID(s)
sscinames Subject scientific name(s)
scomnames Subject common name(s)

-evalue : E-value Threshold

The E-value (Expect value) represents the number of alignments with a given score that would be expected by chance in a database of that size. It is the most important statistical measure in BLAST.

-evalue 1e-05    ## Only report hits with E-value <= 0.00001
E-value Interpretation
< 1e-50 Nearly identical sequences
1e-50 to 1e-10 Very strong homology
1e-10 to 1e-05 Strong homology, likely related
1e-05 to 0.01 Moderate homology, possible relationship
0.01 to 1 Weak hit, borderline significance
> 1 Not significant, likely random match
10 (default) BLAST default; includes many weak/random hits

The E-value depends on database size. The same alignment will have a lower (more significant) E-value in a smaller database. When comparing results across different databases, consider this effect.

-num_threads : Number of CPU Threads

Controls parallelism for faster searches. More threads = faster search, up to a limit.

-num_threads 4   ## Use 4 CPU cores

Check how many cores are available:

nproc              ## Linux
sysctl -n hw.ncpu  ## macOS

BLAST scales well up to ~8 threads. Beyond that, diminishing returns are common. If you have a very large query file, splitting the input (e.g., with DCBLAST or seqkit split) and running separate jobs is more efficient than using many threads on a single job.

-max_target_seqs : Maximum Number of Target Sequences

Limits the number of subject sequences reported for each query.

-max_target_seqs 5   ## Report up to 5 hits per query

Important: -max_target_seqs does NOT guarantee the top N hits by E-value. BLAST uses a heuristic search and keeps the first N qualifying hits encountered. To reliably get the best N hits, set -max_target_seqs to a higher number and then sort the output by E-value afterward.

-out : Output File

By default, BLAST prints results to the terminal (stdout). Use -out to save to a file:

-out blastx_results.txt

-word_size : Word Size

Controls the initial seed length for finding matches. Smaller values increase sensitivity but decrease speed.

Program Default Sensitive Fast
blastn 11 7 28
blastp 3 2 6
blastx 3 2 6
-word_size 7   ## More sensitive nucleotide search

-matrix : Scoring Matrix (protein BLAST only)

Specifies the substitution matrix for scoring amino acid alignments.

Matrix Best for Identity Range
BLOSUM62 General purpose (default) 30-40% identity
BLOSUM80 Closely related sequences >50% identity
BLOSUM45 Distantly related sequences <30% identity
PAM250 Distantly related sequences <30% identity
PAM30 Closely related sequences >60% identity
-matrix BLOSUM80   ## For closely related protein sequences

-gapopen / -gapextend : Gap Penalties

Control the cost of introducing and extending gaps in alignments.

Matrix Default gapopen Default gapextend
BLOSUM62 11 1
BLOSUM80 10 1
BLOSUM45 15 2
-gapopen 11 -gapextend 1   ## Default for BLOSUM62

-query_cov and -subject_cov : Coverage Filters

Filter hits by minimum query or subject coverage percentage (BLAST+ 2.12+):

-qcov_hsp_perc 70   ## Only report HSPs covering at least 70% of the query

-max_hsps : Maximum HSPs per Subject

Limits the number of HSPs (High-Scoring Segment Pairs) reported per query-subject pair:

-max_hsps 1   ## Report only the best HSP for each query-subject pair

Putting It All Together

blastx -query ATH_100.fasta \
       -db plant.1.protein.faa \
       -out blastx_results.txt \
       -outfmt "6 qseqid sseqid pident length evalue bitscore qcovs stitle" \
       -evalue 1e-10 \
       -max_target_seqs 5 \
       -num_threads 4 \
       -matrix BLOSUM62 \
       -word_size 3 \
       -max_hsps 1 \
       -qcov_hsp_perc 50

This command:

Question

  • find the option below within BLASTX
    1. Set output to file
    2. Set tabular output format
    3. Set maximum target sequence to one
    4. Set threads (CPU) to 32
    5. Set evalue threshold to 1e-30

Answer

blastx -query ATH_100.fasta -db plant.1.protein.faa \
       -out output.txt \
       -outfmt 6 \
       -max_target_seqs 1 \
       -num_threads 32 \
       -evalue 1e-30

DCBLAST

The Basic Local Alignment Search Tool (BLAST) is by far best the most widely used tool in for sequence analysis for rapid sequence similarity searching among nucleic acid or amino acid sequences. Recently, cluster, HPC, grid, and cloud environmentshave been are increasing more widely used and more accessible as high-performance computing systems. Divide and Conquer BLAST (DCBLAST) has been designed to perform run on grid system with query splicing which can run National Center for Biotechnology Information (NCBI) BLASTBLAST search comparisons over withinthe cluster, grid, and cloud computing grid environment by using a query sequence distribution approach NCBI BLAST. This is a promising tool to accelerate BLAST job dramatically accelerates the execution of BLAST query searches using a simple, accessible, robust, and practical approach.

blast

Requirement

Following basic softwares are needed to run

which perl
perl --version

For using recent version, please update BLAST path in config.ini

which blastn

Prerequisites

The following Perl modules are required:

- Path::Tiny
- Data::Dumper
- Config::Tiny

Install prerequisites with the following command:

cpan `cat requirement`

or

cpanm `cat requirement`

or

cpanm Path::Tiny Data::Dumper Config::Tiny

We strongly recommend to use Perlbrew http://perlbrew.pl/ to avoid having to type sudo

We also recommend to use ‘cpanm’ https://github.com/miyagawa/cpanminus

Prerequisites by Conda

conda activate blast
conda install -c bioconda perl-path-tiny blast perl-data-dumper perl-config-tiny -y

Installation

The program is a single file Perl scripts. Copy it into executive directories.

We recommend to copy it on scratch disk.

cd ~/bch709/BLAST

## If you haven't already downloaded and unzipped the input file:
# wget https://ftp.ensemblgenomes.org/pub/plants/release-60/fasta/arabidopsis_thaliana/cds/Arabidopsis_thaliana.TAIR10.cds.all.fa.gz -O Athaliana_TAIR10.cds.fa.gz
# gunzip Athaliana_TAIR10.cds.fa.gz

git clone https://github.com/wyim-pgl/DCBLAST.git

cd DCBLAST/DCBLAST-SLURM

pwd

chmod 775 dcblast.pl

perl dcblast.pl

Help

Usage : dcblast.pl --ini config.ini --input input-fasta --size size-of-group --output output-filename-prefix  --blast blast-program-name

  --ini <ini filename> ##config file ex)config.ini

  --input <input filename> ##query fasta file

  --size <output size> ## size of chunks usually all core x 2, if you have 160 core all nodes, you can use 320. please check it to your admin.

  --output <output filename> ##output folder name

  --blast <blast name> ##blastp, blastx, blastn and etcs.

  --dryrun Option will only split fasta file into chunks

Configuration

Please edit config.ini with nano before you run!!

[dcblast]
##Name of job (will use for SGE job submission name)
job_name_prefix=dcblast

[blast]
##BLAST options

##BLAST path (your blast+ path); run "which blastn" then remove "blastn" from the path
path=~/miniconda3/envs/blast/bin/

##DB path (build your own BLAST DB)
##example
##makeblastdb -in example/test_db.fas -dbtype nucl (for nucleotide sequence)
##makeblastdb -in example/your-protein-db.fas -dbtype prot (for protein sequence)
db=~/bch709/BLAST/plant.1.protein.faa

##Evalue cut-off (See BLAST manual)
evalue=1e-05

##number of threads in each job. If your CPU is AMD it needs to be set 1.
num_threads=2

##Max target sequence output (See BLAST manual)
max_target_seqs=10

##Output format (See BLAST manual)
outfmt=6

##any other option can be add it this area
#matrix=BLOSUM62
#gapopen=11
#gapextend=1

[oldsge]
##Grid job submission commands (for SGE-based HPC systems)
pe=SharedMem 1
M=your@email
q=common.q
j=yes
o=log
cwd=

[slurm]
##Slurm job submission settings (adjust for your cluster)
time=04:00:00
cpus-per-task=1
mem-per-cpu=800M
ntasks=1
output=log
error=error
partition=cpu-core-0
account=cpu-s5-bch709-3
mail-type=all
mail-user=your@email

If you need any other options for your enviroment please contant us or admin

PBS & LSF need simple code hack. If you need it please request through issue.

Run DCBLAST

Run (–dryrun option will only split fasta file into chunks)

perl dcblast.pl --ini config.ini --input ~/bch709/BLAST/Athaliana_TAIR10.cds.fa --output test --size 100 --blast blastx

Check job status:

squeue  ## for Slurm

or

qstat   ## for SGE

It usually finishes within up to 20 min depending on HPC status and CPU speed.

Running BLAST Locally Without a Job Scheduler

If you do not have access to an HPC cluster (Slurm/SGE), you can run BLAST directly on your local machine:

cd ~/bch709/BLAST

## Make sure your database is built
makeblastdb -in plant.1.protein.faa -dbtype prot

## Run blastx locally using multiple threads
blastx -query Athaliana_TAIR10.cds.fa \
       -db plant.1.protein.faa \
       -out blastx_results.txt \
       -outfmt 6 \
       -evalue 1e-05 \
       -max_target_seqs 10 \
       -num_threads 4

For local runs, adjust -num_threads to the number of CPU cores available on your machine. You can check with nproc (Linux) or sysctl -n hw.ncpu (macOS).

Citation

Won C. Yim and John C. Cushman (2017) Divide and Conquer BLAST: using grid engines to accelerate BLAST and other sequence analysis tools. PeerJ 10.7717/peerj.3486 https://peerj.com/articles/3486/


BLAST Output Formats

BLAST supports multiple output formats controlled by the -outfmt option. Understanding these is essential for downstream analysis.

Format Description
0 Pairwise (default, human-readable)
5 BLAST XML
6 Tabular (without headers)
7 Tabular (with comment headers)
8 Text ASN.1
10 CSV (comma-separated values)
11 BLAST archive (ASN.1)

Custom Tabular Output

You can customize which columns appear in tabular output (-outfmt 6 or -outfmt 7) by specifying field names:

blastx -query ATH_100.fasta \
       -db plant.1.protein.faa \
       -outfmt "6 qseqid sseqid pident length mismatch gapopen qstart qend sstart send evalue bitscore qcovs stitle" \
       -evalue 1e-05 \
       -max_target_seqs 1 \
       -num_threads 4 \
       -out blastx_custom.txt

Additional useful columns:

Filtering and Parsing BLAST Results

Using awk to filter results

## Filter for hits with >80% identity and e-value < 1e-10
awk '$3 > 80 && $11 < 1e-10' blastx_results.txt

## Count number of unique query sequences with hits
awk '{print $1}' blastx_results.txt | sort -u | wc -l

## Get the best hit (lowest e-value) for each query
sort -k1,1 -k11,11g blastx_results.txt | sort -k1,1 -u

Using SeqKit to extract sequences

## Extract query IDs from BLAST results
awk '{print $1}' blastx_results.txt | sort -u > hit_ids.txt

## Extract FASTA sequences for those IDs
seqkit grep -f hit_ids.txt Athaliana_TAIR10.cds.fa > hits.fasta

Reciprocal Best BLAST Hit (RBH)

Reciprocal Best BLAST Hit is a common method to identify putative orthologs between two species. The logic is simple: if gene A in species 1 finds gene B as its best hit in species 2, and gene B finds gene A as its best hit in species 1, then A and B are reciprocal best hits and likely orthologs.

Step 1: Forward BLAST (Species 1 vs Species 2)

cd ~/bch709/BLAST

## Download a second protein database (e.g., rice)
wget ftp://ftp.ncbi.nih.gov/refseq/release/plant/plant.2.protein.faa.gz
gunzip plant.2.protein.faa.gz
makeblastdb -in plant.2.protein.faa -dbtype prot

## Forward BLAST: Arabidopsis -> plant DB 2
blastx -query ATH_100.fasta \
       -db plant.2.protein.faa \
       -outfmt "6 qseqid sseqid pident evalue bitscore" \
       -evalue 1e-05 \
       -max_target_seqs 1 \
       -num_threads 4 \
       -out forward_blast.txt

Step 2: Reverse BLAST (Species 2 vs Species 1)

## Extract subject IDs from forward blast
awk '{print $2}' forward_blast.txt | sort -u > forward_hits.txt

## Extract those sequences from plant.2 database
blastdbcmd -db plant.2.protein.faa -entry_batch forward_hits.txt -out forward_hit_seqs.fasta

## Reverse BLAST: plant DB 2 hits -> Arabidopsis
makeblastdb -in Athaliana_TAIR10.cds.fa -dbtype nucl

tblastn -query forward_hit_seqs.fasta \
        -db Athaliana_TAIR10.cds.fa \
        -outfmt "6 qseqid sseqid pident evalue bitscore" \
        -evalue 1e-05 \
        -max_target_seqs 1 \
        -num_threads 4 \
        -out reverse_blast.txt

Step 3: Find Reciprocal Best Hits

## Create paired lists and find reciprocal matches
awk '{print $1"\t"$2}' forward_blast.txt | sort > forward_pairs.txt
awk '{print $2"\t"$1}' reverse_blast.txt | sort > reverse_pairs.txt

## Find reciprocal best hits
comm -12 forward_pairs.txt reverse_pairs.txt > reciprocal_best_hits.txt
wc -l reciprocal_best_hits.txt

Reciprocal Best BLAST Hit is a simple but effective approach for ortholog identification. For more sophisticated methods, consider tools like OrthoFinder, OrthoMCL, or InParanoid.

Practical Tips for BLAST

Memory and Performance

Common Pitfalls

  1. Wrong database type: Using blastn against a protein database (or vice versa) will produce an error. Always match your query type with the correct BLAST program.
  2. Forgetting to build the index: Running BLAST without first running makeblastdb will fail.
  3. E-value interpretation: An E-value of 0.01 means you expect 1 false positive per 100 database searches. Always consider both E-value and percent identity.
  4. max_target_seqs misconception: -max_target_seqs does not guarantee returning the best N hits. It limits the number of hits kept during the search. For guaranteed best hits, use -max_target_seqs with a larger value and sort results afterward.

Quick Reference: Common BLAST Commands

## BLASTN: nucleotide vs nucleotide
blastn -query query.fna -db nt_db -out results.txt -outfmt 6 -evalue 1e-05 -num_threads 4

## BLASTP: protein vs protein
blastp -query query.faa -db prot_db -out results.txt -outfmt 6 -evalue 1e-05 -num_threads 4

## BLASTX: translated nucleotide vs protein
blastx -query query.fna -db prot_db -out results.txt -outfmt 6 -evalue 1e-05 -num_threads 4

## TBLASTN: protein vs translated nucleotide
tblastn -query query.faa -db nt_db -out results.txt -outfmt 6 -evalue 1e-05 -num_threads 4

## TBLASTX: translated nucleotide vs translated nucleotide
tblastx -query query.fna -db nt_db -out results.txt -outfmt 6 -evalue 1e-05 -num_threads 4

Homework: Run a BLASTX search with the full Arabidopsis CDS file against the plant protein database. Try different E-value thresholds (1e-05, 1e-10, 1e-30) and compare the number of hits. Which threshold is most appropriate and why?


DIAMOND: A Fast Alternative to BLAST

DIAMOND is an ultra-fast sequence aligner designed as a drop-in replacement for BLASTP and BLASTX. It can be 100x to 20,000x faster than NCBI BLAST while maintaining comparable sensitivity, making it ideal for large-scale searches such as metagenomic analysis or whole-genome annotation.

Why is DIAMOND Faster than BLAST?

To understand why DIAMOND is so much faster, we first need to understand the bottleneck in BLAST.

How BLAST Works (and Where It’s Slow)

BLAST processes one query at a time through the following steps:

  1. Break the query into short words (seeds of length W, typically 3 for protein)
  2. Look up each seed in the database index to find all matching positions
  3. Extend each seed match in both directions to produce alignments (HSPs)
  4. Score and filter the alignments

The bottleneck is step 2-3: for each query, BLAST must scan through the database index and perform many small extension operations. When you have thousands of queries, this process is repeated for each one independently. The disk I/O and cache misses from random database access dominate the runtime.

How DIAMOND Solves This — Four Key Strategies

DIAMOND uses a fundamentally different strategy with four major innovations:

diamond_concept

1. Double Indexing

BLAST indexes only the database, then scans it for each query one at a time. DIAMOND indexes both the query set and the reference database simultaneously.

BLAST approach (one query at a time):
  Query 1 → scan entire DB index → extend hits → output
  Query 2 → scan entire DB index → extend hits → output
  Query 3 → scan entire DB index → extend hits → output
  ... (repeated N times, many random disk accesses)

DIAMOND approach (batch all queries):
  Load DB block → index ALL queries + DB block together
  → sort all seed matches → extend in sorted order → output
  (sequential memory access, cache-friendly)

All seed matches between query and database are collected and sorted. Instead of randomly jumping through the database for each query, DIAMOND processes matches in a sequential, cache-friendly order. Modern CPUs are dramatically faster when accessing memory sequentially rather than randomly.

The database is loaded in large blocks into memory, and all queries are processed against each block together. This maximizes data reuse and minimizes disk I/O — the database is read from disk once per block, not once per query.

2. Spaced Seeds

Instead of using consecutive letters for seeds (like BLAST’s contiguous word), DIAMOND uses spaced seed patterns:

BLAST contiguous seed (W=3):
  Query:  M  A  S  G  P  G  G  W  L  G
  Seed:  [M  A  S]                        → exact 3-letter match

DIAMOND spaced seed:
  Query:  M  A  S  G  P  G  G  W  L  G
  Seed:  [#  #  _  #  _  _  #  #  _  #]
          M  A  ?  G  ?  ?  G  W  ?  G    → match at # positions, skip _ positions

Where # means “match required” and _ means “any letter allowed” (wildcard). Spaced seeds are mathematically proven to be more sensitive than contiguous seeds of the same weight. This is because:

The same spaced seed concept is used in other fast aligners like PatternHunter, BFAST, and many modern genomic tools.

3. Reduced Alphabet

DIAMOND compresses the 20 amino acid alphabet down to 11 letters by grouping biochemically similar amino acids:

Standard amino acid alphabet (20 letters):
  A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V

DIAMOND reduced alphabet (11 groups):
  [K,R]  [E,D]  [Q,N]  [I,L,M,V]  [F,W,Y]  [A]  [C]  [G]  [H]  [P]  [S,T]

Why this works:

Example: "MKLLV" in reduced alphabet

Standard:  M  K  L  L  V
Reduced:  [ILMV] [KR] [ILMV] [ILMV] [ILMV]   →  4  1  4  4  4

A query "MRLIV" becomes:
Standard:  M  R  L  I  V
Reduced:  [ILMV] [KR] [ILMV] [ILMV] [ILMV]   →  4  1  4  4  4   ← same seed!

The two sequences have different amino acids at positions 2, 4, and 5, but because K/R and I/L/M/V are in the same group, DIAMOND treats them as the same seed — correctly identifying them as potential homologs without needing to check every letter individually.

4. SIMD Vectorization

DIAMOND uses SIMD (Single Instruction, Multiple Data) CPU instructions to accelerate the alignment extension step. This is a hardware-level optimization that processes multiple data elements simultaneously with a single CPU instruction.

Traditional alignment (scalar, one cell at a time):
  Score cell [i,j]     → 1 CPU instruction → 1 result
  Score cell [i,j+1]   → 1 CPU instruction → 1 result
  Score cell [i,j+2]   → 1 CPU instruction → 1 result
  Score cell [i,j+3]   → 1 CPU instruction → 1 result
  ... 4 instructions for 4 results

SIMD alignment (vectorized, multiple cells at once):
  Score cells [i,j] [i,j+1] [i,j+2] [i,j+3]  → 1 CPU instruction → 4 results!
  ... 1 instruction for 4 results (or 8 or 16 depending on SIMD width)

Modern CPUs support several SIMD instruction sets with increasing width:

Instruction Set Register Width Cells per Instruction Speedup
SSE2 128-bit 4 x 32-bit or 8 x 16-bit ~4-8x
AVX2 256-bit 8 x 32-bit or 16 x 16-bit ~8-16x
AVX-512 512-bit 16 x 32-bit or 32 x 16-bit ~16-32x

DIAMOND uses anti-diagonal parallelism in the Smith-Waterman dynamic programming matrix. Cells on the same anti-diagonal are independent of each other (they only depend on cells above, left, and diagonally above-left), so they can be computed simultaneously using SIMD:

Smith-Waterman DP matrix anti-diagonals:

        j=0  j=1  j=2  j=3  j=4
  i=0  [ 0 ] [d1] [d2 ] [d3 ] [d4 ]
  i=1  [d1 ] [d2] [d3 ] [d4 ] [d5 ]
  i=2  [d2 ] [d3] [d4 ] [d5 ] [d6 ]
  i=3  [d3 ] [d4] [d5 ] [d6 ] [d7 ]

  d1: 2 cells   → computed in parallel via SIMD
  d2: 3 cells   → computed in parallel via SIMD
  d3: 4 cells   → computed in parallel via SIMD
  d4: 4 cells   → computed in parallel via SIMD  (max parallelism)
  ...

Additionally, DIAMOND batches multiple alignments into a single SIMD operation. Instead of aligning one query-subject pair at a time, it packs multiple independent alignment computations into the same SIMD registers — so 8 or 16 different alignments are computed simultaneously.

You can check which SIMD instructions your CPU supports:

## Linux
grep -o 'sse2\|avx2\|avx512' /proc/cpuinfo | sort -u

## macOS
sysctl -a | grep machdep.cpu.features | grep -oi 'sse2\|avx2\|avx512'

DIAMOND automatically detects and uses the best available SIMD instruction set on your CPU. No configuration is needed — it will use AVX2 if available, falling back to SSE2 on older hardware. This is one reason DIAMOND runs faster on newer CPUs.

Summary: Four Pillars of DIAMOND Speed

Strategy What It Does Speedup Factor
Double Indexing Batch-processes all queries together; converts random I/O to sequential 10-100x
Spaced Seeds More sensitive seed pattern; finds more homologs per lookup 2-3x sensitivity gain at same speed
Reduced Alphabet Shrinks seed space from 8,000 to 1,331; smaller index, faster lookups 3-6x
SIMD Vectorization Computes 8-16 alignment cells simultaneously using AVX2/SSE2 8-16x

The key insight is that DIAMOND trades memory for speed. By loading large chunks of data into RAM and processing all queries together, it converts random I/O into sequential I/O — and sequential access can be 100-1000x faster than random access on modern hardware. Combined with hardware-accelerated alignment via SIMD, the cumulative effect is the 100-20,000x speedup over BLAST.

DIAMOND vs BLAST Comparison

Feature NCBI BLAST DIAMOND
Speed Baseline 100-20,000x faster
Sensitivity (default) High Slightly lower (~1-2% fewer hits)
Sensitivity (--sensitive) High Comparable to BLAST
Sensitivity (--very-sensitive) High Equal or better than BLAST
Programs supported blastn, blastp, blastx, tblastn, tblastx blastp, blastx
Nucleotide vs nucleotide Yes (blastn) No
Memory usage Low-moderate Higher (uses block loading)
Best for Small queries, nucleotide searches Large-scale protein searches, metagenomics

Installation

conda activate blast
conda install -c bioconda diamond -y

Or create a separate environment:

conda create -n diamond -c bioconda -c conda-forge diamond seqkit -y
conda activate diamond

Building a DIAMOND Database

DIAMOND uses its own database format (.dmnd), which is more compact than BLAST databases:

cd ~/bch709/BLAST

## Build DIAMOND database from protein FASTA
diamond makedb --in plant.1.protein.faa --db plant.1.protein

## This creates plant.1.protein.dmnd
ls -lh plant.1.protein.dmnd

DIAMOND databases are typically 5-10x smaller than equivalent BLAST databases and faster to build.

Running DIAMOND BLASTX

The basic syntax mirrors NCBI BLAST, making it easy to switch:

cd ~/bch709/BLAST

## DIAMOND blastx (equivalent to NCBI blastx)
diamond blastx \
    --query Athaliana_TAIR10.cds.fa \
    --db plant.1.protein \
    --out diamond_blastx_results.txt \
    --outfmt 6 qseqid sseqid pident length mismatch gapopen qstart qend sstart send evalue bitscore \
    --evalue 1e-05 \
    --max-target-seqs 10 \
    --threads 4

Running DIAMOND BLASTP

## DIAMOND blastp (equivalent to NCBI blastp)
diamond blastp \
    --query your_protein.fasta \
    --db plant.1.protein \
    --out diamond_blastp_results.txt \
    --outfmt 6 \
    --evalue 1e-05 \
    --max-target-seqs 5 \
    --threads 4

Sensitivity Modes

DIAMOND offers multiple sensitivity levels. Higher sensitivity = slower speed but more hits found:

## Default mode (fast, good for closely related sequences)
diamond blastx --query query.fa --db db --out results_default.txt --outfmt 6

## Sensitive mode (catches more distant homologs)
diamond blastx --query query.fa --db db --out results_sensitive.txt --outfmt 6 --sensitive

## More-sensitive mode
diamond blastx --query query.fa --db db --out results_moresens.txt --outfmt 6 --more-sensitive

## Very-sensitive mode (closest to BLAST sensitivity)
diamond blastx --query query.fa --db db --out results_verysens.txt --outfmt 6 --very-sensitive

## Ultra-sensitive mode (maximum sensitivity, slowest)
diamond blastx --query query.fa --db db --out results_ultrasens.txt --outfmt 6 --ultra-sensitive
Mode Speed vs BLAST Sensitivity vs BLAST
default ~20,000x faster ~98% of BLAST hits
--sensitive ~2,500x faster ~99% of BLAST hits
--more-sensitive ~1,000x faster ~99.5% of BLAST hits
--very-sensitive ~300x faster ~99.8% of BLAST hits
--ultra-sensitive ~100x faster ~100% of BLAST hits

DIAMOND Output Formats

DIAMOND supports the same -outfmt 6 column specifiers as NCBI BLAST:

diamond blastx \
    --query ATH_100.fasta \
    --db plant.1.protein \
    --outfmt 6 qseqid sseqid pident length evalue bitscore qcovhsp stitle \
    --evalue 1e-05 \
    --max-target-seqs 1 \
    --threads 4 \
    --out diamond_custom.txt

Additional DIAMOND-specific output formats:

Format Description
0 BLAST pairwise (human-readable)
5 BLAST XML
6 BLAST tabular (customizable columns)
100 DIAMOND alignment archive (DAA) — binary format, convertible later
101 SAM
102 Taxonomic classification
103 PAF (minimap2-compatible)

DAA Format: DIAMOND Alignment Archive

The DAA format stores all alignment information in a compact binary file. You can convert it to other formats later without re-running the search:

## Run DIAMOND and save as DAA
diamond blastx \
    --query Athaliana_TAIR10.cds.fa \
    --db plant.1.protein \
    --out results.daa \
    --outfmt 100 \
    --evalue 1e-05 \
    --threads 4

## Convert DAA to tabular format
diamond view --daa results.daa --outfmt 6 --out results_tab.txt

## Convert DAA to XML format
diamond view --daa results.daa --outfmt 5 --out results.xml

## Convert with custom columns
diamond view --daa results.daa \
    --outfmt 6 qseqid sseqid pident evalue stitle \
    --out results_custom.txt

The DAA format is useful when you want to run a search once and then explore results in multiple formats without repeating the computation.

Key DIAMOND Options

Option Description Example
--query Input query FASTA file --query query.fa
--db DIAMOND database (without .dmnd) --db plant.1.protein
--out Output file --out results.txt
--outfmt Output format and columns --outfmt 6 qseqid sseqid pident evalue
--evalue E-value threshold --evalue 1e-05
--max-target-seqs Max hits per query --max-target-seqs 10
--threads Number of CPU threads --threads 4
--id Minimum percent identity --id 80
--query-cover Minimum query coverage (%) --query-cover 50
--subject-cover Minimum subject coverage (%) --subject-cover 50
--top Report hits within this % of best score --top 10
--block-size Sequence block size (billions of letters) --block-size 2.0
--index-chunks Number of index chunks --index-chunks 4
--memory-limit Memory limit (GB) --memory-limit 8
--tmpdir Temp directory for large searches --tmpdir /tmp

Memory Tuning

For machines with limited RAM, adjust --block-size and --index-chunks:

## Low memory machine (e.g., laptop with 8 GB RAM)
diamond blastx \
    --query Athaliana_TAIR10.cds.fa \
    --db plant.1.protein \
    --out results.txt \
    --outfmt 6 \
    --block-size 0.5 \
    --index-chunks 4 \
    --threads 4

## High memory machine (e.g., server with 64+ GB RAM)
diamond blastx \
    --query Athaliana_TAIR10.cds.fa \
    --db plant.1.protein \
    --out results.txt \
    --outfmt 6 \
    --block-size 4.0 \
    --index-chunks 1 \
    --threads 16

--block-size controls how many billions of sequence letters are processed at once. Lower values use less memory but run slower. --index-chunks splits the database index; higher values reduce memory but increase runtime. The defaults work well for most machines with 16+ GB RAM.

Practical Example: BLAST vs DIAMOND Speed Comparison

cd ~/bch709/BLAST

## Subsample 1000 sequences for testing
seqkit sample -n 1000 Athaliana_TAIR10.cds.fa.gz > ATH_1000.fasta

## Time NCBI BLASTX
time blastx -query ATH_1000.fasta \
            -db plant.1.protein.faa \
            -out ncbi_blast_results.txt \
            -outfmt 6 \
            -evalue 1e-05 \
            -max_target_seqs 5 \
            -num_threads 4

## Time DIAMOND BLASTX
time diamond blastx \
    --query ATH_1000.fasta \
    --db plant.1.protein \
    --out diamond_results.txt \
    --outfmt 6 \
    --evalue 1e-05 \
    --max-target-seqs 5 \
    --threads 4

## Compare the number of hits
echo "NCBI BLAST hits:"
wc -l ncbi_blast_results.txt
echo "DIAMOND hits:"
wc -l diamond_results.txt

When to Use DIAMOND vs BLAST

Scenario Recommended Tool
Small query (<100 sequences) against small DB NCBI BLAST
Large query (thousands+ sequences) against protein DB DIAMOND
Metagenomics / environmental sequencing DIAMOND
Nucleotide vs nucleotide (blastn) NCBI BLAST (DIAMOND doesn’t support this)
Need maximum sensitivity for distant homologs NCBI BLAST or DIAMOND --ultra-sensitive
Genome annotation pipeline DIAMOND
Quick functional annotation DIAMOND
tblastn or tblastx searches NCBI BLAST (DIAMOND doesn’t support these)

Citation

Buchfink B, Xie C, Huson DH (2015) Fast and sensitive protein alignment using DIAMOND. Nature Methods, 12:59-60. doi:10.1038/nmeth.3176